PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013593005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 190aa    MW: 22396.2 Da    PI: 11.6609
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013593005.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.93e-1061961147
                     HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +l ++v+ +G+ +W+ Ia++m+ gRt+k+ ++rw++ 
   XP_013593005.1 61 QLMELVTVYGPQNWNHIAEKMQ-GRTGKSRRLRWFNQ 96
                     799*******************.***********996 PP

2Myb_DNA-binding491.4e-15104147247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++++eE+e+l+ a++ +G+  W+ Ia+ ++ gRt++ + ++w+ +
   XP_013593005.1 104 RAFSPEEEERLLAAHRAFGNX-WAMIAKLFN-GRTDNALMNHWHVL 147
                      689******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.295399IPR001005SANT/Myb domain
CDDcd001674.94E-56195No hitNo description
Gene3DG3DSA:1.10.10.607.0E-1961104IPR009057Homeodomain-like
PfamPF002492.3E-86196IPR001005SANT/Myb domain
PROSITE profilePS500906.986297IPR017877Myb-like domain
SuperFamilySSF466898.41E-2377155IPR009057Homeodomain-like
PROSITE profilePS5129423.6998152IPR017930Myb domain
SMARTSM007177.9E-13102150IPR001005SANT/Myb domain
PfamPF002492.5E-12104147IPR001005SANT/Myb domain
CDDcd001673.02E-8105148No hitNo description
Gene3DG3DSA:1.10.10.601.6E-19105152IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MSLCVYIRHG YRRETKRRAR WISLVSKKPM QWSWILKESD ESKKKQRGPR VCSRGHWRIX  60
QLMELVTVYG PQNWNHIAEK MQGRTGKSRR LRWFNQLDPR INKRAFSPEE EERLLAAHRA  120
FGNXWAMIAK LFNGRTDNAL MNHWHVLMAR KLRQQSTFHI XNGSAHKPTA DHISVNLSLG  180
LCLLLTLSSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-246115214105MYB PROTO-ONCOGENE PROTEIN
1h8a_C3e-246215238128MYB TRANSFORMING PROTEIN
1mse_C2e-246115214105C-Myb DNA-Binding Domain
1msf_C2e-246115214105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2727328e-92AF272732.1 Arabidopsis thaliana putative transcription factor (MYB110) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013593005.11e-138PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB44
TrEMBLM4FD662e-84M4FD66_BRARP; Uncharacterized protein
STRINGBra039036.1-P5e-84(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63001846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G29020.13e-70myb domain protein 110